PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0150s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 437aa    MW: 48355.6 Da    PI: 9.0586
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0150s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-3387141155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Kalax.0150s0013.1.p  87 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 141
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.80184144IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-3284142IPR009057Homeodomain-like
SuperFamilySSF466892.33E-1686142IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-2387142IPR006447Myb domain, plants
PfamPF002493.5E-889139IPR001005SANT/Myb domain
PfamPF143794.6E-21180219IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MHTAFPPFPD SLPSSKTEPY SPPLYESHLF IFARRETKQQ AARNSAYSKK KKKMFHSKKP  60
SSMNNSPHER AMCVQGDSGL VLTTDPKPRL RWTVELHERF VDAVAQLGGP DKATPKTIMR  120
VMGVKGLTLY HLKSHLQKFR LGKQPHKEFN EHSLKDVSAL ELQRSNTSSS GMMGRNMNEM  180
QLEVQRRLHE QLEVQRHLQL RIEAQGKYMQ AILEKACQTL AGENNHNMAS GSSSYNNMKA  240
GIGNNQGVGG QHHQDLDAIK DFASLGFPSL LDLSIYGQAA AGGDQIDLHQ SNFDSNDTDN  300
SRPPSMDVFI HDPNTNDDAI CLGNPKKRPS PYISSSGNGK GPLLWSDDLR LQDLGTATTQ  360
SCHDIQIGPP PSTSPAMEET LFETKPMSLN GDPMMGEKAI KLERPSPRRV PHVSSVDRMM  420
NPVMSMSQGR SSSPFG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14858KKKKKMFHSKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008226001.11e-148PREDICTED: myb family transcription factor APL
SwissprotQ9SAK51e-120APL_ARATH; Myb family transcription factor APL
TrEMBLA5ASR11e-148A5ASR1_VITVI; Putative uncharacterized protein
STRINGVIT_19s0085g00890.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-112G2-like family protein